PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29686.m000890
Common NameLOC8276332, RCOM_0622120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB
Protein Properties Length: 556aa    MW: 60406.2 Da    PI: 4.8728
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29686.m000890genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.4e-184087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
    29686.m000890 40 KGPWTSAEDAILIEYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding53.94.1e-1793136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE++l++++++++G++ W++ a++++ gRt++++k++w++
    29686.m000890  93 KGAFTQEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.6893587IPR017930Myb domain
SuperFamilySSF466895.24E-3139134IPR009057Homeodomain-like
SMARTSM007173.6E-163989IPR001005SANT/Myb domain
PfamPF002494.2E-164087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-254194IPR009057Homeodomain-like
CDDcd001673.41E-124287No hitNo description
PROSITE profilePS5129426.87288142IPR017930Myb domain
SMARTSM007172.3E-1792140IPR001005SANT/Myb domain
PfamPF002494.4E-1693136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2695141IPR009057Homeodomain-like
CDDcd001671.11E-1295136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MSHTTNESDD GLFSKDRIDS PLAEGGNCGG SANGGAMLKK GPWTSAEDAI LIEYVKKHGE  60
GNWNAVQKHS GLSRCGKSCR LRWANHLRPN LKKGAFTQEE EQLIIELHAK MGNKWARMAA  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PEVSFQALQE SHQGLTIGGI NTGDKVHGDL  180
LRNNGYEIPD VIFDSLKASQ GISPYVPELA DITTSSMLIK GLSSSQYGSF MSPSAHRQKR  240
LRESTTFIPG YSGNIKSEFP LFDQFQDESC DKVAQSFGLS FPFDPDPTKN PQSFGENQGS  300
HTLANGDFST SKLTSGPVKL ELPSLQYPET DLGSWGTSPP PLLETLDNFI QSPPTAIIES  360
SPRNSGLLDA LLYEAKALSS AKNHSSEKSS NSSTVTPGEL AECSAINICE TEWEDYGDPL  420
SPLGHTATSL FSECTPISAS GSSLDEPPPT DTFTGCIVKT ELVSQPWSPE RDKETTTRVD  480
ITRPDALLAS DWLGQGSGYI KDQVIMTDNI ATLLGDDLSS DYKQMSAGAS TSNQVWGLGS  540
CAWNNMPAVC QMSELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-33381415107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015578736.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015578735.10.0PREDICTED: transcription factor GAMYB
RefseqXP_002525574.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015578734.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015578733.10.0PREDICTED: transcription factor GAMYB
TrEMBLB9SHV50.0B9SHV5_RICCO; R2r3-myb transcription factor, putative
STRINGPOPTR_0003s18900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-141myb domain protein 33